4.38 Rating by ClearWebStats
bkgyandeepschool.com is 4 years 2 months 3 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, bkgyandeepschool.com is SAFE to browse.
Get Custom Widget

Traffic Report of Bkgyandeepschool

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View bkgyandeepschool.com site advisor rating Not Applicable

Where is bkgyandeepschool.com server located?

Hosted IP Address:

103.73.189.42 View other site hosted with bkgyandeepschool.com

Hosted Country:

bkgyandeepschool.com hosted country IN bkgyandeepschool.com hosted country

Location Latitude:

20.0063

Location Longitude:

77.006

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View bkgyandeepschool.com HTML resources

Homepage Links Analysis

B.K.Gyandeep Public School

Website Inpage Analysis

H1 Headings: 8 H2 Headings: 11
H3 Headings: 16 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 22
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.73.189.42)

Elma Webpage Title

bkgyandeepschool.com favicon - secondghar.com

Your description

View bkgyandeepschool.com Pagerank   bkgyandeepschool.com alexa rank Not Applicable   bkgyandeepschool.com website value $ 8.95

Sree Ramakrishna Ashram Vidyapith

bkgyandeepschool.com favicon - sreeramakrishnashramavidyapith.com

View bkgyandeepschool.com Pagerank   bkgyandeepschool.com alexa rank Not Applicable   bkgyandeepschool.com website value $ 8.95

Christ Church Convent School

bkgyandeepschool.com favicon - christchurchconventschool.com

View bkgyandeepschool.com Pagerank   bkgyandeepschool.com alexa rank Not Applicable   bkgyandeepschool.com website value $ 8.95

BlackBoard Edutech | Login

bkgyandeepschool.com favicon - bbedut.com

View bkgyandeepschool.com Pagerank   bkgyandeepschool.com alexa rank 608,195   bkgyandeepschool.com website value $ 1,200.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 03 Mar 2020 16:38:44 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for bkgyandeepschool.com

Domain Registrar: GODADDY.COM, LLC bkgyandeepschool.com registrar info
Registration Date: 2020-02-26 4 years 2 months 3 weeks ago
Last Modified: 2020-02-27 4 years 2 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bbedut.com bkgyandeepschool.com name server information 103.73.189.42 bkgyandeepschool.com server is located in India India
ns2.bbedut.com bkgyandeepschool.com name server information 103.73.189.43 bkgyandeepschool.com server is located in India India

DNS Record Analysis

Host Type TTL Extra
bkgyandeepschool.com A 10779 IP:103.73.189.42
bkgyandeepschool.com NS 86400 Target:ns2.bbedut.com
bkgyandeepschool.com NS 86400 Target:ns1.bbedut.com
bkgyandeepschool.com SOA 10800 MNAME:ns1.bbedut.com
RNAME:localalert.bbedut.com
Serial:2020022702
Refresh:3600
Retry:1800
Expire:1209600
bkgyandeepschool.com MX 14400 Target:bkgyandeepschool.com
bkgyandeepschool.com TXT 14400 TXT:v=spf1 +a +mx +ip4:103.73.189.42 ~all

Similarly Ranked Websites to Bkgyandeepschool

Google

bkgyandeepschool.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View bkgyandeepschool.com Pagerank   Alexa rank for bkgyandeepschool.com 1   website value of bkgyandeepschool.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

bkgyandeepschool.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View bkgyandeepschool.com Pagerank   Alexa rank for bkgyandeepschool.com 1   website value of bkgyandeepschool.com $ 8,833,062,960.00

Gmail

bkgyandeepschool.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View bkgyandeepschool.com Pagerank   Alexa rank for bkgyandeepschool.com 1   website value of bkgyandeepschool.com $ 8,833,062,960.00

Android Apps on Google Play

bkgyandeepschool.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View bkgyandeepschool.com Pagerank   Alexa rank for bkgyandeepschool.com 1   website value of bkgyandeepschool.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

bkgyandeepschool.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View bkgyandeepschool.com Pagerank   Alexa rank for bkgyandeepschool.com 1   website value of bkgyandeepschool.com $ 8,833,062,960.00

Full WHOIS Lookup for bkgyandeepschool.com

Domain Name: BKGYANDEEPSCHOOL.COM
Registry Domain ID: 2497071345_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-02-27T05:21:03Z
Creation Date: 2020-02-26T10:26:10Z
Registry Expiry Date: 2021-02-26T10:26:10Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BBEDUT.COM
Name Server: NS2.BBEDUT.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-03-03T16:38:50Z